PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA87G00395
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 255aa    MW: 30077.8 Da    PI: 9.3169
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA87G00395genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-182067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd+ll+d+v+ +G g+W+++ar  g++R +k+c++rw +yl
       AA87G00395 20 KGPWTSEEDKLLIDYVRCHGEGRWNSVARLTGLKRNGKSCRLRWVNYL 67
                     79******************************9*************97 PP

2Myb_DNA-binding52.79.5e-1773117147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
       AA87G00395  73 RGQITPHEESIILELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 117
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.861967IPR017930Myb domain
SuperFamilySSF466896.88E-3019114IPR009057Homeodomain-like
SMARTSM007173.6E-141969IPR001005SANT/Myb domain
PfamPF002493.2E-162067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-232174IPR009057Homeodomain-like
CDDcd001671.71E-92267No hitNo description
PROSITE profilePS5129424.35868122IPR017930Myb domain
SMARTSM007173.9E-1572120IPR001005SANT/Myb domain
PfamPF002495.5E-1473117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2475121IPR009057Homeodomain-like
CDDcd001671.13E-977118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSWWGVKGGG WGMVEGCWRK GPWTSEEDKL LIDYVRCHGE GRWNSVARLT GLKRNGKSCR  60
LRWVNYLRPD LKRGQITPHE ESIILELHAK WGNRWSTIAR SLPGRTDNEI KNYWRTHFKK  120
KTKPNTNNIE KIKNRLLKRQ QFKQQRQMEL HQEQQLFQFN QLDMKKIMYL LEDNENNDDD  180
HNKSNSTSSD HSSLFYVPQE TNTNKTEEEL QGRYGLVNIP EAGVSKDENA IWDGFWNLDV  240
VDGHGGRYCS VWPKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-262012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285781.11e-124hypothetical protein CARUB_v10007255mg
TrEMBLR0GP771e-124R0GP77_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.9__1__AT4G13480.11e-109(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-95myb domain protein 79